CacheBy
Atlas Antibodies Anti-YARS2 Antibody
원본

Atlas Antibodies Anti-YARS2 Antibody

상품 한눈에 보기

인간 YARS2 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 특이적으로 반응하며 Mouse 및 Rat과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057610-100 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057610-25 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YARS2 Antibody

Anti-YARS2 Antibody

Target: tyrosyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human YARS2


Alternative Gene Names

CGI-04, FLJ13995, mt-TyrRS

Open Datasheet


Target Information

항목 내용
Target Protein tyrosyl-tRNA synthetase 2, mitochondrial
Target Gene YARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000022792 (93%), Rat ENSRNOG00000025252 (92%)

Antigen Sequence

TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.