
원본
Atlas Antibodies Anti-YARS2 Antibody
상품 한눈에 보기
인간 YARS2 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 특이적으로 반응하며 Mouse 및 Rat과 높은 서열 유사성을 가집니다.
- 카탈로그번호
- HPA057610-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057610-100 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057610-25 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-YARS2 Antibody
Anti-YARS2 Antibody
Target: tyrosyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human YARS2
Alternative Gene Names
CGI-04, FLJ13995, mt-TyrRS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tyrosyl-tRNA synthetase 2, mitochondrial |
| Target Gene | YARS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022792 (93%), Rat ENSRNOG00000025252 (92%) |
Antigen Sequence
TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



