CacheBy
Atlas Antibodies Anti-XDH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XDH Antibody

상품 한눈에 보기

인간 XDH를 표적으로 하는 토끼 유래 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, XO/XOR 유전자 대체명으로도 알려져 있습니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA062641-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062641-100 Anti-XDH Antibody, xanthine dehydrogenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062641-25 Anti-XDH Antibody, xanthine dehydrogenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XDH Antibody

Anti-XDH Antibody

Target Information

  • Target Protein: Xanthine Dehydrogenase
  • Target Gene: XDH
  • Alternative Gene Names: XO, XOR
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human xanthine dehydrogenase (XDH).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000024066): 87%
  • Rat (ENSRNOG00000007081): 84%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.