CacheBy
Atlas Antibodies Anti-WT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WT1 Antibody

상품 한눈에 보기

인간 WT1 단백질을 인식하는 토끼 폴리클로날 항체로, 윌름스 종양 관련 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 검증되었습니다. 면역형광 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA053848-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053848-100 Anti-WT1 Antibody, Wilms tumor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053848-25 Anti-WT1 Antibody, Wilms tumor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WT1 Antibody

Anti-WT1 Antibody

Target Information

  • Target Protein: Wilms tumor 1
  • Target Gene: WT1
  • Alternative Gene Names: AWT1, GUD, WAGR, WIT-2

Product Description

Polyclonal antibody against human WT1.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence:
PHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGY

  • Immunocytochemistry (ICC)
  • Other applications to be optimized by the user

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000016458) – 98%
  • Rat (ENSRNOG00000013074) – 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.