CacheBy
Atlas Antibodies Anti-WT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WT1 Antibody

상품 한눈에 보기

인간 WT1 단백질을 인식하는 토끼 폴리클로날 항체로, 윌름스 종양 관련 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 검증되었습니다. 면역형광 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053848-100 Anti-WT1 Antibody, Wilms tumor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053848-25 Anti-WT1 Antibody, Wilms tumor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WT1 Antibody

Anti-WT1 Antibody

Target Information

  • Target Protein: Wilms tumor 1
  • Target Gene: WT1
  • Alternative Gene Names: AWT1, GUD, WAGR, WIT-2

Product Description

Polyclonal antibody against human WT1.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence:
PHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGY

  • Immunocytochemistry (ICC)
  • Other applications to be optimized by the user

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000016458) – 98%
  • Rat (ENSRNOG00000013074) – 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.