CacheBy
Atlas Antibodies Anti-IL1RAPL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL1RAPL2 Antibody

상품 한눈에 보기

Human IL1RAPL2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. 재조합 발현 검증을 완료하였으며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036129-100 Anti-IL1RAPL2 Antibody, interleukin 1 receptor accessory protein-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036129-25 Anti-IL1RAPL2 Antibody, interleukin 1 receptor accessory protein-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL1RAPL2 Antibody

Anti-IL1RAPL2 Antibody

interleukin 1 receptor accessory protein-like 2


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human IL1RAPL2


Alternative Gene Names

IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1

Open Datasheet


Target Information

항목 내용
Target Protein interleukin 1 receptor accessory protein-like 2
Target Gene IL1RAPL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000059203 100%
Rat ENSRNOG00000062221 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.