Atlas Antibodies Anti-IL1R1 Antibody

상품 한눈에 보기

Human IL1R1을 인식하는 rabbit polyclonal antibody로, IHC와 WB에 적합. PrEST 항원을 사용한 affinity purification 방식. 높은 특이성과 재현성을 제공하며, 다양한 종 교차 반응 정보 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029560-100 Anti-IL1R1 Antibody, interleukin 1 receptor, type I 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029560-25 Anti-IL1R1 Antibody, interleukin 1 receptor, type I 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-IL1R1 Antibody

Anti-IL1R1 Antibody

Target Information

Target Protein: Interleukin 1 receptor, type I
Target Gene: IL1R1
Alternative Gene Names: CD121A, D2S1473, IL1R, IL1RA

Product Description

Polyclonal antibody against human IL1R1, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000014504	64%
Mouse	ENSMUSG00000026072	64%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand