CacheBy
Atlas Antibodies Anti-IL12RB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL12RB1 Antibody

상품 한눈에 보기

Human IL12RB1 단백질을 인식하는 Rabbit Polyclonal 항체로, interleukin 12 receptor beta 1 타깃 검출에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 시료에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074414-100 Anti-IL12RB1 Antibody, interleukin 12 receptor, beta 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074414-25 Anti-IL12RB1 Antibody, interleukin 12 receptor, beta 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL12RB1 Antibody

Anti-IL12RB1 Antibody

Target: interleukin 12 receptor, beta 1 (IL12RB1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human IL12RB1.

Alternative Gene Names

CD212, IL12RB

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interleukin 12 receptor, beta 1
Target Gene IL12RB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019216 (46%), Mouse ENSMUSG00000111872 (45%)

Antigen Sequence

TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


  • Immunocytochemistry (ICC)
    (이미지의 OCR 텍스트: "ICC" 아이콘)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.