CacheBy
Atlas Antibodies Anti-IKBKAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IKBKAP Antibody

상품 한눈에 보기

인간 IKBKAP 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG 형태로, WB 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인간에 대해 검증된 반응성을 갖습니다. 보존액은 PBS와 glycerol을 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049677-100 Anti-IKBKAP Antibody, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049677-25 Anti-IKBKAP Antibody, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IKBKAP Antibody

Anti-IKBKAP Antibody

Target: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IKBKAP.


Alternative Gene Names

DYS, ELP1, IKAP, IKI3, TOT1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Target Gene IKBKAP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016725 (76%), Mouse ENSMUSG00000028431 (73%)

Antigen Sequence:

NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.