CacheBy
Atlas Antibodies Anti-IGFN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGFN1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-IGFN1 Polyclonal Antibody는 인간 IGFN1 단백질을 표적으로 하며, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체로, 토끼 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050415-100 Anti-IGFN1 Antibody, immunoglobulin-like and fibronectin type III domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050415-25 Anti-IGFN1 Antibody, immunoglobulin-like and fibronectin type III domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGFN1 Antibody

Anti-IGFN1 Antibody

Target: immunoglobulin-like and fibronectin type III domain containing 1 (IGFN1)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human IGFN1


Alternative Gene Names

  • DKFZp434B1231
  • EEF1A2BP1

Open Datasheet


Target Information

항목 내용
Target Protein immunoglobulin-like and fibronectin type III domain containing 1
Target Gene IGFN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000026087 (76%), Mouse ENSMUSG00000051985 (76%)

Antigen Sequence:
AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.