CacheBy
Atlas Antibodies Anti-IGFBP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGFBP5 Antibody

상품 한눈에 보기

인슐린 유사 성장인자 결합 단백질 5(IGFBP5)를 인식하는 사람 유래 폴리클로날 항체. 토끼 숙주에서 생산되었으며, Affinity purification을 통해 정제됨. 인간 시료에 반응하며 ICC 등 다양한 응용에 적합. 안정적인 PBS/glycerol buffer로 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059827-100 Anti-IGFBP5 Antibody, insulin like growth factor binding protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059827-25 Anti-IGFBP5 Antibody, insulin like growth factor binding protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGFBP5 Antibody

Anti-IGFBP5 Antibody

Target: Insulin-like Growth Factor Binding Protein 5 (IGFBP5)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IGFBP5.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Insulin-like Growth Factor Binding Protein 5
Target Gene IGFBP5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antigen Sequence:

DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.