CacheBy
Atlas Antibodies Anti-IFT57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFT57 Antibody

상품 한눈에 보기

인간 IFT57 단백질을 표적으로 하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 동일성을 보유. 40% 글리세롤 및 PBS 완충액에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035515-100 Anti-IFT57 Antibody, intraflagellar transport 57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035515-25 Anti-IFT57 Antibody, intraflagellar transport 57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFT57 Antibody

Anti-IFT57 Antibody

Target Information

  • Target Protein: Intraflagellar transport 57
  • Target Gene: IFT57
  • Alternative Gene Names: ESRRBL1, FLJ10147, HIPPI, MHS4R2

Product Description

Polyclonal antibody against human IFT57.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000001958 94%
Mouse ENSMUSG00000032965 93%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

IHC Application
WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.