CacheBy
Atlas Antibodies Anti-IFNGR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFNGR1 Antibody

상품 한눈에 보기

Human IFNGR1 인식 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되어 정확한 IFNGR1 검출에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063871-100 Anti-IFNGR1 Antibody, interferon gamma receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063871-25 Anti-IFNGR1 Antibody, interferon gamma receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFNGR1 Antibody

Anti-IFNGR1 Antibody

Target Information

  • Target Protein: Interferon gamma receptor 1
  • Target Gene: IFNGR1
  • Alternative Gene Names: CD119, IFNGR

Product Description

Polyclonal antibody against human IFNGR1.
Affinity purified using the PrEST antigen as affinity ligand.

Interferon gamma receptor 1 detection in immunohistochemistry (IHC) and other research assays.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000020009): 54%
  • Rat (ENSRNOG00000012074): 53%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Recommended Application IHC and related assays

Notes

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.