CacheBy
Atlas Antibodies Anti-IFNGR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFNGR2 Antibody

상품 한눈에 보기

인간 IFNGR2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며 RNA-seq 데이터와의 직교 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001535-100 Anti-IFNGR2 Antibody, interferon gamma receptor 2 (interferon gamma transducer 1) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001535-25 Anti-IFNGR2 Antibody, interferon gamma receptor 2 (interferon gamma transducer 1) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFNGR2 Antibody

Anti-IFNGR2 Antibody

Target: interferon gamma receptor 2 (interferon gamma transducer 1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC compared to RNA-seq data of corresponding target in high and low expression tissues.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IFNGR2.


Alternative Gene Names

  • AF-1
  • IFNGT1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interferon gamma receptor 2 (interferon gamma transducer 1)
Target Gene IFNGR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022965 (57%), Rat ENSRNOG00000002032 (57%)

Antigen Sequence:
ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.