CacheBy
Atlas Antibodies Anti-IFNAR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFNAR1 Antibody

상품 한눈에 보기

인간 IFNAR1을 인식하는 폴리클로날 항체로, IHC 및 ICC 적용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되었고, 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029226-100 Anti-IFNAR1 Antibody, interferon (alpha, beta and omega) receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029226-25 Anti-IFNAR1 Antibody, interferon (alpha, beta and omega) receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFNAR1 Antibody

Anti-IFNAR1 Antibody

Target Information

  • Protein: Interferon (alpha, beta and omega) receptor 1
  • Gene: IFNAR1
  • Alternative Gene Names: IFNAR, IFRC
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IFNAR1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000028594 (46%)
  • Mouse ENSMUSG00000022967 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.