CacheBy
Atlas Antibodies Anti-IFIT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFIT3 Antibody

상품 한눈에 보기

Human IFIT3 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 단백질 발현 검증. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059914-100 Anti-IFIT3 Antibody, interferon-induced protein with tetratricopeptide repeats 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059914-25 Anti-IFIT3 Antibody, interferon-induced protein with tetratricopeptide repeats 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFIT3 Antibody

Anti-IFIT3 Antibody

Target: interferon-induced protein with tetratricopeptide repeats 3 (IFIT3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression validated using WB in comparison to RNA-seq data of corresponding targets in high and low expression cell lines.


Product Description

Polyclonal antibody against human IFIT3.


Alternative Gene Names

CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G

Open Datasheet


Target Information

항목 내용
Target Protein interferon-induced protein with tetratricopeptide repeats 3
Target Gene IFIT3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
Verified Species Reactivity Human
Interspecies Identity Mouse (31%), Rat (29%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 실험 조건 및 희석 배수는 사용자가 최적화해야 합니다.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.