
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IFIT3 Antibody
상품 한눈에 보기
Human IFIT3 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 단백질 발현 검증. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059914-100 Anti-IFIT3 Antibody, interferon-induced protein with tetratricopeptide repeats 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059914-25 Anti-IFIT3 Antibody, interferon-induced protein with tetratricopeptide repeats 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IFIT3 Antibody
Anti-IFIT3 Antibody
Target: interferon-induced protein with tetratricopeptide repeats 3 (IFIT3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Orthogonal validation:
Protein expression validated using WB in comparison to RNA-seq data of corresponding targets in high and low expression cell lines.
Product Description
Polyclonal antibody against human IFIT3.
Alternative Gene Names
CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | interferon-induced protein with tetratricopeptide repeats 3 |
| Target Gene | IFIT3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (31%), Rat (29%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 실험 조건 및 희석 배수는 사용자가 최적화해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



