CacheBy
Atlas Antibodies Anti-IFIH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFIH1 Antibody

상품 한눈에 보기

Human IFIH1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 다양한 종 간 교차 반응성 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002656-100 Anti-IFIH1 Antibody, interferon induced with helicase C domain 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002656-25 Anti-IFIH1 Antibody, interferon induced with helicase C domain 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFIH1 Antibody

Anti-IFIH1 Antibody

Target: interferon induced with helicase C domain 1 (IFIH1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human IFIH1.


Alternative Gene Names

Hlcd, IDDM19, MDA-5, MDA5

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interferon induced with helicase C domain 1
Target Gene IFIH1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000006227 (76%), Mouse ENSMUSG00000026896 (75%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.