Atlas Antibodies Anti-IFI44 Antibody

상품 한눈에 보기

Human IFI44 단백질을 인식하는 폴리클로날 항체로, 면역염색(IHC) 등 다양한 연구용 응용에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 정제되었습니다. Human에 특이적으로 반응하며, 안정적인 PBS/glycerol buffer에 보존됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027148-100 Anti-IFI44 Antibody, interferon-induced protein 44 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027148-25 Anti-IFI44 Antibody, interferon-induced protein 44 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-IFI44 Antibody

Anti-IFI44 Antibody

Target Information

Target Protein: Interferon-induced protein 44
Target Gene: IFI44
Alternative Gene Names: MTAP44, p44, TLDC5

Product Description

Polyclonal antibody against Human IFI44.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000028037): 43%
Rat (ENSRNOG00000022218): 38%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	Immunohistochemistry (IHC)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.