
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ICMT Antibody
상품 한눈에 보기
Human ICMT 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현 검증)에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 기반 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA032025-100 Anti-ICMT Antibody, isoprenylcysteine carboxyl methyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032025-25 Anti-ICMT Antibody, isoprenylcysteine carboxyl methyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ICMT Antibody
Anti-ICMT Antibody
isoprenylcysteine carboxyl methyltransferase
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ICMT
Alternative Gene Names
HSTE14, PCCMT, PPMT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | isoprenylcysteine carboxyl methyltransferase |
| Target Gene | ICMT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000039662 (95%) Rat ENSRNOG00000010953 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



