CacheBy
Atlas Antibodies Anti-ICOSLG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ICOSLG Antibody

상품 한눈에 보기

Human ICOSLG 단백질을 인식하는 토끼 폴리클로날 항체로, ICOS 리간드 연구에 적합합니다. 높은 특이성과 재현성을 제공하며, 면역세포 활성화 연구에 유용합니다. PrEST 항원을 이용해 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029179-100 Anti-ICOSLG Antibody, inducible T-cell costimulator ligand 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029179-25 Anti-ICOSLG Antibody, inducible T-cell costimulator ligand 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ICOSLG Antibody

Anti-ICOSLG Antibody

Target Information

  • Target Protein: inducible T-cell costimulator ligand
  • Target Gene: ICOSLG
  • Alternative Gene Names: B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653

Product Description

Polyclonal antibody against human ICOSLG.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence was used for immunization.

Antigen Sequence:

KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000023109 (59%)
  • Mouse ENSMUSG00000000732 (50%)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Preservative Sodium azide (0.02%)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.