CacheBy
Atlas Antibodies Anti-ICE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ICE1 Antibody

상품 한눈에 보기

Human ICE1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식이며 Affinity purification으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 특이성과 재현성을 제공. ICE1 유전자 및 관련 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061934-100 Anti-ICE1 Antibody, interactor of little elongation complex ELL subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061934-25 Anti-ICE1 Antibody, interactor of little elongation complex ELL subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ICE1 Antibody

Anti-ICE1 Antibody

Target: interactor of little elongator complex ELL subunit 1 (ICE1)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 생물학적 분석에 권장됩니다.


Product Description

Polyclonal antibody against human ICE1.


Alternative Gene Names

  • KIAA0947

Open Datasheet


Target Information

항목 내용
Target Protein interactor of little elongator complex ELL subunit 1
Target Gene ICE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000034525 (48%), Rat ENSRNOG00000023053 (46%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Antigen Sequence

ALSPELGASNFNDQKSSGIEYTKVVKGLTKIHSLPRSVFMKATKDGQCESQDPRIELTLNKPDFTSLIGSQAALIKSGLGFVKSTSWHHSDLLRKGG


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.