AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HYAL4 Antibody
상품 한눈에 보기
인간 HYAL4 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 응용에 적합. 토끼 유래 IgG 형식으로 생산되며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 아지드 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029453-100 Anti-HYAL4 Antibody, hyaluronoglucosaminidase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029453-25 Anti-HYAL4 Antibody, hyaluronoglucosaminidase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HYAL4 Antibody
Anti-HYAL4 Antibody
Target Information
- Target Protein: Hyaluronoglucosaminidase 4
- Target Gene: HYAL4
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQ
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000029680): 73%
- Rat (ENSRNOG00000007212): 68%
Product Description
Polyclonal antibody against human HYAL4.
Clonality and Isotype
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.