AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HYAL1 Antibody
상품 한눈에 보기
Human HYAL1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal Validation 제공. Rabbit 호스트에서 생산되었으며, Affinity Purified 방식으로 정제됨. 40% 글리세롤 및 PBS 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002112-100 Anti-HYAL1 Antibody, hyaluronoglucosaminidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002112-25 Anti-HYAL1 Antibody, hyaluronoglucosaminidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HYAL1 Antibody
Anti-HYAL1 Antibody
Target Protein: hyaluronoglucosaminidase 1
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HYAL1
Alternative Gene Names
FUS2, HYAL-1, LUCA1, NAT6
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000015858 | 73% |
| Mouse | ENSMUSG00000010051 | 72% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.