
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HTR1A Antibody
상품 한눈에 보기
인간 HTR1A 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. 면역조직화학 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증되어 신뢰성 높은 결과 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018073-100 Anti-HTR1A Antibody, 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018073-25 Anti-HTR1A Antibody, 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HTR1A Antibody
Anti-HTR1A Antibody
Target: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal antibody against Human HTR1A
Alternative Gene Names
- 5-HT1A
- ADRB2RL1
- ADRBRL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled |
| Target Gene | HTR1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010254 (72%), Mouse ENSMUSG00000021721 (69%) |
Antigen Sequence
VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



