CacheBy
Atlas Antibodies Anti-HTR1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HTR1A Antibody

상품 한눈에 보기

인간 HTR1A 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. 면역조직화학 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증되어 신뢰성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018073-100 Anti-HTR1A Antibody, 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018073-25 Anti-HTR1A Antibody, 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HTR1A Antibody

Anti-HTR1A Antibody

Target: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구 응용에 적합


Product Description

Polyclonal antibody against Human HTR1A


Alternative Gene Names

  • 5-HT1A
  • ADRB2RL1
  • ADRBRL1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Target Gene HTR1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000010254 (72%), Mouse ENSMUSG00000021721 (69%)

Antigen Sequence

VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.