Atlas Antibodies Anti-HSPA5 Antibody
Human HSPA5 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. IHC 및 WB에서 독립적·정교하게 검증된 항체. GRP78/BiP 단백질 검출에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 보존성과 신뢰성 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-HSPA5 Antibody
Anti-HSPA5 Antibody
Target: heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human HSPA5
Alternative Gene Names: BiP, GRP78
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) |
| Target Gene | HSPA5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026864 (100%), Rat ENSRNOG00000018294 (99%) |
Antigen Sequence:
EKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.