
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HSD11B1L Antibody
상품 한눈에 보기
Human HSD11B1L 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간에 반응성이 검증되었으며, 글리세롤 기반 완충액에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049078-100 Anti-HSD11B1L Antibody, hydroxysteroid (11-beta) dehydrogenase 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049078-25 Anti-HSD11B1L Antibody, hydroxysteroid (11-beta) dehydrogenase 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HSD11B1L Antibody
Anti-HSD11B1L Antibody
Target Protein: hydroxysteroid (11-beta) dehydrogenase 1-like
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human HSD11B1L protein.
Alternative Gene Names
SCDR10, SDR26C2
Target Information
- Target Gene: HSD11B1L
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Mouse (ENSMUSG00000016194): 41%
- Rat (ENSRNOG00000005861): 38%
Recommended Applications
Immunocytochemistry (ICC)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Store at -20°C; avoid repeated freeze-thaw cycles |
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



