AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HS3ST5 Antibody
상품 한눈에 보기
인간 HS3ST5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간 시료에 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021823-100 Anti-HS3ST5 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021823-25 Anti-HS3ST5 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HS3ST5 Antibody
Anti-HS3ST5 Antibody
heparan sulfate (glucosamine) 3-O-sulfotransferase 5
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human HS3ST5
Alternative Gene Names
- 3-OST-5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | heparan sulfate (glucosamine) 3-O-sulfotransferase 5 |
| Target Gene | HS3ST5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHF |
Species Reactivity
- Verified: Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000000605 | 91% |
| Mouse | ENSMUSG00000044499 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.