CacheBy
Atlas Antibodies Anti-HPGDS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HPGDS Antibody

상품 한눈에 보기

인간 HPGDS 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. PBS-글리세롤 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024035-100 Anti-HPGDS Antibody, hematopoietic prostaglandin D synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024035-25 Anti-HPGDS Antibody, hematopoietic prostaglandin D synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HPGDS Antibody

Anti-HPGDS Antibody

Target Information

  • Target Protein: Hematopoietic prostaglandin D synthase
  • Target Gene: HPGDS
  • Alternative Gene Names: GSTS, GSTS1-1, H-PGDS, PGD2, PGDS

Product Description

Polyclonal antibody against human HPGDS.

면역조직화학(IHC) 등 다양한 연구용 응용에 적합.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000029919 73%
Rat ENSRNOG00000006583 73%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.