
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HPGDS Antibody
상품 한눈에 보기
인간 HPGDS 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. PBS-글리세롤 버퍼에 보존제로 나트륨 아지드 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024035-100 Anti-HPGDS Antibody, hematopoietic prostaglandin D synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024035-25 Anti-HPGDS Antibody, hematopoietic prostaglandin D synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HPGDS Antibody
Anti-HPGDS Antibody
Target Information
- Target Protein: Hematopoietic prostaglandin D synthase
- Target Gene: HPGDS
- Alternative Gene Names: GSTS, GSTS1-1, H-PGDS, PGD2, PGDS
Product Description
Polyclonal antibody against human HPGDS.
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000029919 | 73% |
| Rat | ENSRNOG00000006583 | 73% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 적합한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



