Atlas Antibodies Anti-HP Antibody

상품 한눈에 보기

Human HP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다. 인간에 대한 반응성이 검증된 연구용 항체입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047750-100 Anti-HP Antibody, haptoglobin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047750-25 Anti-HP Antibody, haptoglobin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-HP Antibody

Anti-HP Antibody

Target Information

Target Protein: Haptoglobin
Target Gene: HP

Product Description

Polyclonal antibody against human HP (Haptoglobin).
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG

Species Reactivity

Verified Species: Human
Interspecies Homology:
- Rat ENSRNOG00000014964 (83%)
- Mouse ENSMUSG00000031722 (81%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)