
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HOXC11 Antibody
상품 한눈에 보기
Human HOXC11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 40% 글리세롤 PBS 버퍼에 보존되어 안정적 장기 보관 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038291-100 Anti-HOXC11 Antibody, homeobox C11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038291-25 Anti-HOXC11 Antibody, homeobox C11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HOXC11 Antibody
Anti-HOXC11 Antibody
Target Protein: homeobox C11
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human HOXC11.
Alternative Gene Names
- HOX3H
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
STVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSSVNKNSVLP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016141 | 99% |
| Mouse | ENSMUSG00000001656 | 99% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



