Atlas Antibodies Anti-HORMAD2 Antibody

상품 한눈에 보기

인간 HORMAD2 단백질을 인식하는 토끼 폴리클로날 항체. IHC와 WB에서 검증됨. 정제된 PrEST 항원을 사용한 친화 정제 방식. 인간에 대한 반응성이 확인되었으며, 설치류와의 높은 상동성 보유. 다양한 응용에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003074-100 Anti-HORMAD2 Antibody, HORMA domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003074-25 Anti-HORMAD2 Antibody, HORMA domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

HORMA domain containing 2

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human HORMAD2

CT46.2, MGC26710

항목	내용
Target Protein	HORMA domain containing 2
Target Gene	HORMAD2
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence	QLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTK

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000037865	85%
Mouse	ENSMUSG00000020419	82%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet