AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HOGA1 Antibody
상품 한눈에 보기
Human HOGA1 단백질을 인식하는 Rabbit Polyclonal 항체로, 4-hydroxy-2-oxoglutarate aldolase 1 연구에 적합. 높은 종간 보존성(인간-쥐 90%, 인간-마우스 89%)을 가짐. Affinity purification으로 높은 특이성과 재현성 제공. 다양한 응용 분야에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039466-100 Anti-HOGA1 Antibody, 4-hydroxy-2-oxoglutarate aldolase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039466-25 Anti-HOGA1 Antibody, 4-hydroxy-2-oxoglutarate aldolase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HOGA1 Antibody
Anti-HOGA1 Antibody
Target Protein: 4-hydroxy-2-oxoglutarate aldolase 1
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human HOGA1 (4-hydroxy-2-oxoglutarate aldolase 1).
Alternative Gene Names
C10orf65, DHDPS2, DHDPSL, FLJ37472, NPL2
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | 4-hydroxy-2-oxoglutarate aldolase 1 |
| Target Gene | HOGA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (90%), Mouse (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Recommended Applications | IHC (Immunohistochemistry) |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.