Atlas Antibodies Anti-HMGCS2 Antibody

상품 한눈에 보기

Human HMGCS2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었으며 마우스 및 랫트와 높은 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027442-100 Anti-HMGCS2 Antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027442-25 Anti-HMGCS2 Antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
Target Gene: HMGCS2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
ASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG
```

Polyclonal antibody against human HMGCS2.

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000027875	87%
Rat	ENSRNOG00000019120	87%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand