
원본
Thermo Fisher Scientific PRAMEF1 Polyclonal Antibody
상품 한눈에 보기
Human PRAMEF1 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot 검증 완료. 합성 펩타이드(N-말단 aa 118-167)를 면역원으로 사용. 액상 형태, 0.5 mg/mL 농도, -20°C 보관.
- 카탈로그번호
- PA546595
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:35
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA546595 PRAMEF1 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
630,500원VAT 포함 693,550원
Thermo Fisher Scientific · Thermo Fisher Scientific PRAMEF1 Polyclonal Antibody
Thermo Fisher Scientific PRAMEF1 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human PRAMEF1 (aa 118–167) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2609904 |
Product Specific Information
- Peptide sequence: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL
- Sequence homology: Human: 100%
Target Information
This gene is a member of the PRAME (preferentially expressed antigen of melanoma) gene family, which is expressed in many cancers but may function in reproductive tissues during development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(PA5-46595_PRAMEF1_O95521-1_Rabbit_PDP.jpeg, PA5-46595_PRAMEF1_O95521-1_Rabbit.svg)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
