CacheBy
Atlas Antibodies Anti-HLA-E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HLA-E Antibody

상품 한눈에 보기

인체 HLA-E 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 세포면역염색(ICC)에 적합. 토끼에서 생산된 IgG 형 항체이며, 고순도 친화정제 방식으로 제조됨. 인체 특이성이 검증되어 신뢰성 높은 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031454-100 Anti-HLA-E Antibody, major histocompatibility complex, class I, E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031454-25 Anti-HLA-E Antibody, major histocompatibility complex, class I, E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HLA-E Antibody

Anti-HLA-E Antibody

Target: major histocompatibility complex, class I, E
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human HLA-E

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein major histocompatibility complex, class I, E
Target Gene HLA-E
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000067235 (75%), Rat ENSRNOG00000050210 (71%)

Antigen Sequence:
RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.