Atlas Antibodies Anti-HK3 Antibody

상품 한눈에 보기

Human HK3 단백질을 표적으로 하는 rabbit polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, orthogonal validation으로 검증되었습니다. 인간 특이적 반응성을 가지며, glycerol/PBS buffer에 보존되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056743-100 Anti-HK3 Antibody, hexokinase 3 (white cell) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056743-25 Anti-HK3 Antibody, hexokinase 3 (white cell) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-HK3 Antibody

Anti-HK3 Antibody

Target: hexokinase 3 (white cell)

Recommended Applications

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody against human HK3.

Open Datasheet

Target Information

항목	내용
Target Protein	hexokinase 3 (white cell)
Target Gene	HK3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000025877 (69%), Rat ENSRNOG00000026235 (67%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)