CacheBy
Atlas Antibodies Anti-HIVEP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HIVEP1 Antibody

상품 한눈에 보기

Human HIVEP1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 보장. CIRIP, CRYBP1 등 다양한 유전자명으로 알려진 HIVEP1 타깃 검출에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067457-100 Anti-HIVEP1 Antibody, human immunodeficiency virus type I enhancer binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067457-25 Anti-HIVEP1 Antibody, human immunodeficiency virus type I enhancer binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HIVEP1 Antibody

Anti-HIVEP1 Antibody

Target Protein: Human immunodeficiency virus type I enhancer binding protein 1 (HIVEP1)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human HIVEP1.

Alternative Gene Names

CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATLPTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000014460 52%
Mouse ENSMUSG00000021366 50%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.