
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HINT2 Antibody
상품 한눈에 보기
Human HINT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 인체 단백질 발현 검증에 적합. 40% 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020961-100 Anti-HINT2 Antibody, histidine triad nucleotide binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020961-25 Anti-HINT2 Antibody, histidine triad nucleotide binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HINT2 Antibody
Anti-HINT2 Antibody
Target Protein: histidine triad nucleotide binding protein 2 (HINT2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Independent Validation:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human HINT2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | histidine triad nucleotide binding protein 2 |
| Target Gene | HINT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP |
Species Reactivity
| 종 | 반응성 | 항원 서열 유사도 |
|---|---|---|
| Human | Verified | - |
| Rat | Predicted | 89% (ENSRNOG00000015866) |
| Mouse | Predicted | 88% (ENSMUSG00000028470) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



