AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HERC4 Antibody
상품 한눈에 보기
Human HERC4 단백질을 인식하는 토끼 폴리클로날 항체로, E3 유비퀴틴 리가아제 연구용에 적합. 높은 종간 보존성(마우스 99%, 랫 98%)을 보이며, PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070301-100 Anti-HERC4 Antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070301-25 Anti-HERC4 Antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HERC4 Antibody
Anti-HERC4 Antibody
HECT and RLD domain containing E3 ubiquitin protein ligase 4
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.
Product Description
- Type: Polyclonal Antibody against Human HERC4
- Supplier: Atlas Antibodies
Alternative Gene Names
- DKFZP564G092
- KIAA1593
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | HECT and RLD domain containing E3 ubiquitin protein ligase 4 |
| Target Gene | HERC4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000020064): 99%
- Rat (ENSRNOG00000061040): 98%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.