
원본
Atlas Antibodies Anti-HEPHL1 Antibody
상품 한눈에 보기
Human HEPHL1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보임. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031517-100 Anti-HEPHL1 Antibody, hephaestin-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031517-25 Anti-HEPHL1 Antibody, hephaestin-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HEPHL1 Antibody
Anti-HEPHL1 Antibody
Target Protein: hephaestin-like 1
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human HEPHL1 (hephaestin-like 1).
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
- DKFZp686F22190
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
HLRGTHRDSLALFPHMATTAFMQPDHAGIFRVFCATMPHLSRGMGQIYEVSSCDNRDPSEQRYGMIRTFYIAAEEVEWDYAPNKNWEFEKQHVDARGERHGDIFMNRTENWIGSQYKKVVYREYTDGEFVEIKARPPR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000056092 | 87% |
| Mouse | ENSMUSG00000031936 | 86% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



