CacheBy
Atlas Antibodies Anti-HELQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HELQ Antibody

상품 한눈에 보기

Human HELQ 단백질을 인식하는 토끼 폴리클로날 항체로, helicase POLQ-like 단백질 연구에 적합. Affinity purification 방식으로 정제됨. 면역세포화학(ICC) 등 다양한 응용 가능. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036852-100 Anti-HELQ Antibody, helicase, POLQ-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036852-25 Anti-HELQ Antibody, helicase, POLQ-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HELQ Antibody

Anti-HELQ Antibody

Target: helicase, POLQ-like
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human HELQ protein.


Alternative Gene Names

  • Hel308

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein helicase, POLQ-like
Target Gene HELQ
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence SGYEGVTIEPGADLLYDVPSSQAIYFENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHNCIEQPQQNDESSSKV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000002181 50%
Mouse ENSMUSG00000035266 44%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.