
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HEBP1 Antibody
상품 한눈에 보기
Human HEBP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성을 가지며, 40% 글리세롤과 PBS 완충액에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075277-100 Anti-HEBP1 Antibody, heme binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075277-25 Anti-HEBP1 Antibody, heme binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HEBP1 Antibody
Anti-HEBP1 Antibody
Target Information
- Target Protein: heme binding protein 1
- Target Gene: HEBP1
- Alternative Gene Names: HBP, HEBP
Product Description
Polyclonal antibody against human HEBP1.
Recommended for use in IHC and ICC applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEERE
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Rat ENSRNOG00000000024 (91%)
- Mouse ENSMUSG00000042770 (91%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



