CacheBy
Atlas Antibodies Anti-HDHD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HDHD2 Antibody

상품 한눈에 보기

인간 HDHD2 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 보존액은 40% 글리세롤과 PBS(pH 7.2)입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040697-100 Anti-HDHD2 Antibody, haloacid dehalogenase-like hydrolase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040697-25 Anti-HDHD2 Antibody, haloacid dehalogenase-like hydrolase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HDHD2 Antibody

Anti-HDHD2 Antibody

Target Information

  • Protein Name: haloacid dehalogenase-like hydrolase domain containing 2
  • Gene Name: HDHD2
  • Alternative Gene Names: DKFZP564D1378

면역조직화학(IHC)

Product Description

Polyclonal antibody against human HDHD2.

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    TVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDH

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Rat ENSRNOG00000043171 89%
Mouse ENSMUSG00000025421 87%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.