Atlas Antibodies Anti-HCLS1 Antibody

상품 한눈에 보기

Human HCLS1 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, CTTNL/HS1 유전자와 관련 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019143-100 Anti-HCLS1 Antibody, hematopoietic cell-specific Lyn substrate 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019143-25 Anti-HCLS1 Antibody, hematopoietic cell-specific Lyn substrate 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-HCLS1 Antibody

Anti-HCLS1 Antibody

Target Information

Target Protein: hematopoietic cell-specific Lyn substrate 1
Target Gene: HCLS1
Alternative Gene Names: CTTNL, HS1

Product Description

Polyclonal Antibody against Human HCLS1 (hematopoietic cell-specific Lyn substrate 1).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recommended Applications

Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSRE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000038881 (75%)
Mouse ENSMUSG00000022831 (75%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	IHC
Verified Species Reactivity	Human