CacheBy
Atlas Antibodies Anti-HAUS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HAUS1 Antibody

상품 한눈에 보기

Human HAUS1 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Rat 및 Mouse와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040601-100 Anti-HAUS1 Antibody, HAUS augmin-like complex, subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040601-25 Anti-HAUS1 Antibody, HAUS augmin-like complex, subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HAUS1 Antibody

Anti-HAUS1 Antibody

HAUS augmin-like complex, subunit 1


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human HAUS1


Alternative Gene Names

CCDC5, FLJ40084, HEI-C, HsT1461

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein HAUS augmin-like complex, subunit 1
Target Gene HAUS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVD

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Identity Rat ENSRNOG00000046666 (85%)
Mouse ENSMUSG00000041840 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.