CacheBy
Atlas Antibodies Anti-HAS1 Antibody
원본

Atlas Antibodies Anti-HAS1 Antibody

상품 한눈에 보기

인간 HAS1 단백질을 인식하는 폴리클로날 항체로 IHC 및 ICC 실험에 적합합니다. 토끼에서 생산된 IgG 형 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었고, 글리세롤/PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067602-100 Anti-HAS1 Antibody, hyaluronan synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067602-25 Anti-HAS1 Antibody, hyaluronan synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HAS1 Antibody

Anti-HAS1 Antibody

Target Information

  • Target Protein: Hyaluronan synthase 1
  • Target Gene: HAS1
  • Alternative Gene Names: HAS
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human HAS1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000010994): 97%
  • Mouse (ENSMUSG00000003665): 96%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.