CacheBy
Atlas Antibodies Anti-HAAO Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HAAO Antibody

상품 한눈에 보기

인간 HAAO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, PBS/glycerol 버퍼에 보존 처리. 인간, 랫, 마우스 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036394-100 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036394-25 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HAAO Antibody

Anti-HAAO Antibody

Target Protein: 3-hydroxyanthranilate 3,4-dioxygenase
Target Gene: HAAO

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human HAAO
Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AWVKENRGSFQPPVCNKLMHQEQLKVMFVGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000031263 94%
Mouse ENSMUSG00000000673 92%

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.