AI 생성

1 / 2

Atlas Antibodies Anti-HAAO Antibody

상품 한눈에 보기

인간 HAAO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, PBS/glycerol 버퍼에 보존 처리. 인간, 랫, 마우스 반응성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036394-100 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036394-25 Anti-HAAO Antibody, 3-hydroxyanthranilate 3,4-dioxygenase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: 3-hydroxyanthranilate 3,4-dioxygenase
Target Gene: HAAO

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human HAAO
Open Datasheet

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AWVKENRGSFQPPVCNKLMHQEQLKVMFVGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQ

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000031263	94%
Mouse	ENSMUSG00000000673	92%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.