CacheBy
Atlas Antibodies Anti-GTF3C5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-GTF3C5 Antibody

상품 한눈에 보기

인간 GTF3C5 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. PBS와 글리세롤 기반 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA069805-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069805-100 Anti-GTF3C5 Antibody, general transcription factor IIIC, polypeptide 5, 63kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069805-25 Anti-GTF3C5 Antibody, general transcription factor IIIC, polypeptide 5, 63kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GTF3C5 Antibody

Anti-GTF3C5 Antibody

general transcription factor IIIC, polypeptide 5, 63kDa

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GTF3C5.

Alternative Gene Names

TFiiiC2-63, TFIIIC63, TFIIICepsilon

Open Datasheet

Target Information

항목 내용
Target Protein general transcription factor IIIC, polypeptide 5, 63kDa
Target Gene GTF3C5
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000010981 (87%), Mouse ENSMUSG00000026816 (86%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
참고 Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-GTPBP1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-GTF3C6 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-GTPBP1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-GTF3C6 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.