CacheBy
Atlas Antibodies Anti-GTF3C2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GTF3C2 Antibody

상품 한눈에 보기

Human GTF3C2 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 글리세롤 기반 완충액에 보존제 포함. 사용 전 부드럽게 혼합 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035836-100 Anti-GTF3C2 Antibody, general transcription factor IIIC, polypeptide 2, beta 110kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035836-25 Anti-GTF3C2 Antibody, general transcription factor IIIC, polypeptide 2, beta 110kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GTF3C2 Antibody

Anti-GTF3C2 Antibody

Target: General transcription factor IIIC subunit 2 (GTF3C2)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GTF3C2.


Alternative Gene Names

  • KIAA0011
  • TFIIIC110

Open Datasheet (PDF)


Target Information

  • Target Protein: General transcription factor IIIC subunit 2
  • Target Gene: GTF3C2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MAPNGLSNHIMAPVWKCLHLTKDFREQKHSYWEFAEWIPLAWKWHLLSELEAAPYLPQEEKSPLFSVQREGLPEDGTLYRINRFSSITAHPERWDVSFFTGGPLWALDWCPVPEGAGASQYVALFSSPDMNETHPLSQLHSGPGL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000056904 92%
Mouse ENSMUSG00000106864 92%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.