Atlas Antibodies Anti-GTF2F1 Antibody

상품 한눈에 보기

인간 GTF2F1 단백질을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현), ICC에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화 정제 방식으로 고순도 확보. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028707-100 Anti-GTF2F1 Antibody, general transcription factor IIF, polypeptide 1, 74kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028707-25 Anti-GTF2F1 Antibody, general transcription factor IIF, polypeptide 1, 74kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: General transcription factor IIF, polypeptide 1 (74 kDa)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Polyclonal antibody against human GTF2F1.

BTF4, RAP74, TF2F1, TFIIF

항목	내용
Target Protein	General transcription factor IIF, polypeptide 1, 74 kDa
Target Gene	GTF2F1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000002658 (98%), Rat ENSRNOG00000047134 (98%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet