CacheBy
Atlas Antibodies Anti-GSDMC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSDMC Antibody

상품 한눈에 보기

인간 GSDMC(gasdermin C)를 인식하는 폴리클로날 항체. Rabbit에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 적합하며, 40% glycerol/PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026317-100 Anti-GSDMC Antibody, gasdermin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026317-25 Anti-GSDMC Antibody, gasdermin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSDMC Antibody

Anti-GSDMC Antibody

Target: gasdermin C (GSDMC)
Type: Polyclonal Antibody against Human GSDMC

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human gasdermin C (GSDMC).

Alternative Gene Names

  • MLZE

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein gasdermin C
Target Gene GSDMC
Verified Species Reactivity Human
Interspecies Identity Mouse (54%), Rat (53%)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.