CacheBy
Atlas Antibodies Anti-GRXCR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRXCR1 Antibody

상품 한눈에 보기

Human GRXCR1 단백질을 표적으로 하는 토끼 폴리클로날 항체입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반 안정화 버퍼로 장기 보존이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040824-100 Anti-GRXCR1 Antibody, glutaredoxin, cysteine rich 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040824-25 Anti-GRXCR1 Antibody, glutaredoxin, cysteine rich 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRXCR1 Antibody

Anti-GRXCR1 Antibody

Target: glutaredoxin, cysteine rich 1 (GRXCR1)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human GRXCR1.


Alternative Gene Names

  • DFNB25
  • PPP1R88

Open Datasheet


Target Information

항목 내용
Target Protein glutaredoxin, cysteine rich 1
Target Gene GRXCR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (97%), Rat (97%)

Antigen Sequence:
GVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.